Transcript | Ll_transcript_412116 |
---|---|
CDS coordinates | 155-559 (+) |
Peptide sequence | MTDYSMPEMTGYELLKKIKESSVFREIPVVVMSSENILTRIDSCLEEGAEDFLLKPVKLSDVKRLTDFMRGEGKIAEKQSPKRRQSDNCTPSLSTMFSLTSYHRNITSPELLPSLSPSASPSKKSRVSKKIELC* |
ORF Type | complete |
Blastp | Two-component response regulator ARR5 from Arabidopsis with 73.03% of identity |
---|---|
Blastx | Two-component response regulator ARR5 from Arabidopsis with 73.33% of identity |
Eggnog | Transcription factor(COG5641) |
Kegg | Link to kegg annotations (AT3G48100) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019416227.1) |
Pfam | Response regulator receiver domain (PF00072.23) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer