Protein coding transcript 123650

• Transcript: Ll_transcript_504890
• CDS coordinates: 2-475 (+)
• Peptide sequence: GGMGMDINDIFSSFFGGGSVEEEERIVKGDDVIVELDVPLEDLYMGGSLKVWREKNVLKPAPGKRRCNCRNEVYHKQIGPGMFQQMTEQVCEQCPNVKYVREGYFITVDIEKGMQDGQEVLFYEDGEPKIDGESGDLRFRIRTAPHDLFRREGNDLHT
• ORF Type: internal

Annotations of Ll_transcript_504890

• Blastp: DnaJ protein ERDJ3B from Arabidopsis with 81.7% of identity
• Blastx: DnaJ protein ERDJ3B from Oryza sativa with 86.57% of identity
• Eggnog: ATP binding to DnaK triggers the release of the substrate protein, thus completing the reaction cycle. Several rounds of ATP-dependent interactions between DnaJ, DnaK and GrpE are required for fully efficient folding. Also involved, together with DnaK and GrpE, in the DNA replication of plasmids through activation of initiation proteins (By similarity)(COG0484)
• Kegg: Link to kegg annotations (AT3G62600)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016205763.1)
• Pfam: DnaJ C terminal domain (PF01556.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;