Protein coding transcript 123651

• Transcript: Ll_transcript_504903
• CDS coordinates: 1-657 (+)
• Peptide sequence: RYGEEGLKQHAASGGRGGGMGMDINDIFSSFFGGGSMEEEEARVVKGDDVIVELNASLEDLYMGGSLKVWREKNVLKPAPGKRRCNCRNEVYHKQIGPGMFQQMTEQVCEQCPNVKFVREGYFVTVDIEKGMQDGQEVLFYEDGEPIIDGESGDLRFRIRTAPHDLFRREGNDLHTTVTITLVSIVVVDMYINWLSYTLSLIYFGQIENHIIGSVYRY*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_504903

• Blastp: DnaJ protein ERDJ3B from Arabidopsis with 80.32% of identity
• Blastx: DnaJ protein ERDJ3B from Oryza sativa with 81.92% of identity
• Eggnog: ATP binding to DnaK triggers the release of the substrate protein, thus completing the reaction cycle. Several rounds of ATP-dependent interactions between DnaJ, DnaK and GrpE are required for fully efficient folding. Also involved, together with DnaK and GrpE, in the DNA replication of plasmids through activation of initiation proteins (By similarity)(COG0484)
• Kegg: Link to kegg annotations (AT3G62600)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421973.1)
• Pfam: DnaJ C terminal domain (PF01556.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;