| Transcript | Ll_transcript_507791 |
|---|---|
| CDS coordinates | 2-370 (+) |
| Peptide sequence | DDKARYMILHLQSPISLKPFCFCITHLSYLFRQITTVYGPCENNRDYLFLLEKALHDIGKLYICTISITDYDSLLKNIKLLTLHTLFCHKLIKIVGMLCCRIESDTFKDGDLLVNRDGVQNL* |
| ORF Type | 5prime_partial |
| Blastp | Gamma-glutamylcyclotransferase 2-2 from Arabidopsis with 72.73% of identity |
|---|---|
| Blastx | Gamma-glutamylcyclotransferase 2-2 from Arabidopsis with 72.73% of identity |
| Eggnog | cation transport(COG3703) |
| Kegg | Link to kegg annotations (AT4G31290) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019438374.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer