Transcript | Ll_transcript_507800 |
---|---|
CDS coordinates | 909-1505 (+) |
Peptide sequence | MGELGLAFVKLTKFETEEAIFEAQRIRATDTRNVATAAVKASRLYRELNTQTIKHLDKLHDYLGTMLAVNNAFADRSSALLTVQTLSSELVSLNSRIEKLEVASSKVFGGDKSRMRKIEELKEAHRVTENAKTCADREYERIKENNRSELERIDKERHDDFFSMLRGFVVNQAGYAEKMAAVWEKLAEETTTYSIDSS* |
ORF Type | complete |
Blastp | Sorting nexin 2A from Arabidopsis with 73.06% of identity |
---|---|
Blastx | Sorting nexin 2A from Arabidopsis with 72.6% of identity |
Eggnog | sorting nexin(COG5391) |
Kegg | Link to kegg annotations (AT5G58440) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019456646.1) |
Pfam | Vps5 C terminal like (PF09325.9) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer