Protein coding transcript 123696

• Transcript: Ll_transcript_505695
• CDS coordinates: 238-765 (+)
• Peptide sequence: MAFSIGSTRRGGGSWSQSILPSTNPKSKVPRKQRKRKVLKDFIFSNFYTIGIVFSLSLFIIILFKFGVPKPITSHFRTRSNRYRKPVNRKSVFLRDGKGGNYTLLAASVDITTKGLYDKIEFLDVDGGAWKQGWSVSYRGNEWDSEKLKVFVVPHSHNDPGWKLTVEEYYDRQSRH
• ORF Type: 3prime_partial

Annotations of Ll_transcript_505695

• Blastp: Alpha-mannosidase 2 from Arabidopsis with 59.52% of identity
• Blastx: Alpha-mannosidase 2 from Arabidopsis with 59.52% of identity
• Eggnog: Mannosidase alpha class(ENOG410XQMZ)
• Kegg: Link to kegg annotations (AT5G14950)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442599.1)
• Pfam: Glycosyl hydrolases family 38 N-terminal domain (PF01074.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;