Transcript | Ll_transcript_506005 |
---|---|
CDS coordinates | 3-299 (+) |
Peptide sequence | RTMASHIVGYPRVGPKRELKFALESFWDGKSSAEDLKKVSAELRASIWKQQAGAGIKYIPSNTFSYYDHVLDATATLGAVPPRYGWPGGELGFATYSPL |
ORF Type | internal |
Blastp | 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase from Cryophytum with 85.11% of identity |
---|---|
Blastx | 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase from Cryophytum with 85.11% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019442939.1) |
Pfam | Cobalamin-independent synthase, N-terminal domain (PF08267.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer