Protein coding transcript 123754

• Transcript: Ll_transcript_506009
• CDS coordinates: 3-629 (+)
• Peptide sequence: RTMASHIVGYPRVGPKRELKFALESFWDGKSRAEDLKKVSTDLRASIWKQQAGAGIKYIPSNTFSYYDQVLDATATLGAVPPRYGWTGGEIEFDTYFSMARGNASVPAMEMTKWFDTNYHFIVPELGPDVNFTYSSHKAVEEYKEAKALGVDTIPVLIGPVSYLILSKPAKGVDKSFSLLSLLPKVIAVYKEVVSALKAAGASWIQFDE
• ORF Type: internal

Annotations of Ll_transcript_506009

• Blastp: 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase from Cryophytum with 87.92% of identity
• Blastx: 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase from Cryophytum with 87.92% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421280.1)
• Pfam: Cobalamin-independent synthase, N-terminal domain (PF08267.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;