Transcript | Ll_transcript_506321 |
---|---|
CDS coordinates | 981-1475 (+) |
Peptide sequence | MELAGQLFDMLKAVGKHHNFCVGLLIGGRKDVDMEKERVNELNILICTPGRLLQHMDETPNFDCSQMQVLVLDEADRILDSGFKRELNAIISQLPMRRQTLLFSATQTKSVQDLARLSLKDPEYLSVHEESVTTTPTLLKQIVMVVPVDQKLDMLWSFIKTHLQ* |
ORF Type | complete |
Blastp | DEAD-box ATP-dependent RNA helicase 32 from Arabidopsis with 73.46% of identity |
---|---|
Blastx | DEAD-box ATP-dependent RNA helicase 32 from Arabidopsis with 70.95% of identity |
Eggnog | purine NTP-dependent helicase activity(COG0513) |
Kegg | Link to kegg annotations (AT5G54910) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019417514.1) |
Pfam | DEAD/DEAH box helicase (PF00270.28) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer