Protein coding transcript 123816

• Transcript: Ll_transcript_506320
• CDS coordinates: 205-1005 (+)
• Peptide sequence: MSSSPSPANMNNVVLEINLISAQGLKPPSSPRRTFQTYALTWIHSDTKLRTRVDKVGGENPTWNDKFLFRVTPDFLASETSGISVAIYAVGTFRDHLIGTVRFLISNILDGDSVRVTPCFSAVQIRRPSGRFHGVMNIGAMLIDGSEIHVLKKKISAIGYRDLMGEKIQLNRKVKSSSSNSNSSENNSYEGSFTESLTDGSESTETASSSTSSPRTVTTALTEWNDVRKLAGAGNKGLTASGFLCCLVANRNRNKTIHLSPSEHEK*
• ORF Type: complete

Annotations of Ll_transcript_506320

• Blastp: BON1-associated protein 2 from Arabidopsis with 26.92% of identity
• Blastx: BON1-associated protein 2 from Arabidopsis with 26.92% of identity
• Eggnog: bon association protein(ENOG410ZCTQ)
• Kegg: Link to kegg annotations (AT2G45760)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418775.1)
• Pfam: C2 domain (PF00168.29)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;