Protein coding transcript 123823

• Transcript: Ll_transcript_505390
• CDS coordinates: 478-957 (+)
• Peptide sequence: MKKLTRDYSLIVAALKESSLLAVSGDGKRVKRLNPQIQFRDNKLYTVLVENLPEDHSRENIHRIFNEAGNIKRITIHDPRPTAEAAKHIKQEKFISNKLHALVEYETIEAAEKAVAMFNDEQDWRNGMHVKLLKRMVSSDLLSPFDKLTLSGVDDGFMI*
• ORF Type: complete

Annotations of Ll_transcript_505390

• Blastp: La-related protein 6A from Arabidopsis with 62.32% of identity
• Blastx: La-related protein 6A from Arabidopsis with 61.74% of identity
• Eggnog: La ribonucleoprotein domain family member 6(ENOG4110VUA)
• Kegg: Link to kegg annotations (AT5G46250)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419761.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;