Protein coding transcript 123827

• Transcript: Ll_transcript_505382
• CDS coordinates: 54-506 (+)
• Peptide sequence: MEGGELVLSSAAASPPPAEITDPSELHSLISDEEHHLDHDHEEHDHEHDRDHDLDEEQHVHDHVVDNDISLDYLKIKILKQVEYYFSDENLPTDKYLLGYVKRNKEGFGKRFRAMWCNNVMPLICFCAIMKYVFALLLLLSRKLGLGLRE*
• ORF Type: complete

Annotations of Ll_transcript_505382

• Blastp: La-related protein 6A from Arabidopsis with 56.34% of identity
• Blastx: La-related protein 6A from Arabidopsis with 67.5% of identity
• Eggnog: La ribonucleoprotein domain family member 6(ENOG4110VUA)
• Kegg: Link to kegg annotations (AT5G46250)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419761.1)
• Pfam: La domain (PF05383.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;