Protein coding transcript 123855

• Transcript: Ll_transcript_507577
• CDS coordinates: 1-522 (+)
• Peptide sequence: MTSFDPCNRSHLVGLWLGCCNLVTRGSPFACISRSHAIFTITLEQMHKLHSISSSNYTSEEDMGEEYISAKLHLVDLAGSERAKRTGSDGLRLQEGIHINKGLLALGNVISALGDEKKRKEGAHVPYRDSKLTRLLQDSLGGNSKTVMIACISPADINAEESLNTLKYANRARN
• ORF Type: 3prime_partial

Annotations of Ll_transcript_507577

• Blastp: Kinesin-like protein KIN-4B from Arabidopsis with 88.03% of identity
• Blastx: Kinesin-like protein KIN-4B from Arabidopsis with 88.03% of identity
• Eggnog: Kinesin family member(COG5059)
• Kegg: Link to kegg annotations (AT3G50240)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446819.1)
• Pfam: Kinesin motor domain (PF00225.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;