Protein coding transcript 123865

• Transcript: Ll_transcript_507599
• CDS coordinates: 2-1189 (+)
• Peptide sequence: QVSLGGNSRTVMIACISPADINAEETLNTLKYANRARNIQNKPVINRDPMSNEMLKMRQQLECLQAELCARAGGSSVEVQVLKERIAWLEAANENLCRELHEYRSRCSVVDQCEKDAHDGSICIAKIDGLKRSLPIVGPDYPMNETAGDSKEIEEVAKEWEHTLLQNSMDKELHELNKRLEQKEFEMKLFGASDAEVLKQHFGRKIMELEDEKRVVQRERDCLLAEVENLAANSDGQTQKLEDIHAHKLKALEAQIIDLKRKQEGQVQLMKQKQKSDEAAKRLQDEIQSIKAQKVQLQQRIKQEAEQFRQWKASREKELLQLKKEGRRNEYERHKLQALNQRQKMVLQRKTEEAAMATKRLKDLLEARKTSIRDALVTMNGSGTNGQVLDSPSSS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_507599

• Blastp: Kinesin-like protein KIN-4A from Gossypium with 77.55% of identity
• Blastx: Kinesin-like protein KIN-4A from Gossypium with 73.26% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (107917911)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437938.1)
• Pfam: Kinesin motor domain (PF00225.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;