Protein coding transcript 123867

• Transcript: Ll_transcript_507602
• CDS coordinates: 2-979 (+)
• Peptide sequence: RAGGSSEEVQVLKERIAWLEVVNENLCRELHEYRRRCSVVEQCDKDAYDGSTCITKTDGLKRSLPFTHPNYPMNETAGDSREIEEVAKEWEHTLLQNSMDRELHELNKRLELKESEMKIFGAPDAELLKQHFGRKIMELEDEKRVVQRERDCLLAEVENLAANSDGQTQKLEDIHAHKLKALEAQIIDLKRKQEGQVQLMKQKQKSDEAAKRLQDEIQSIKAQKVQLQQRIKQEAEQFRQWKASREKELLQLKKEGRRNEYERHKLQALNQRQKMVLQRKTEEAAMATKRLKDLLEARKTSIRDALVTMNGSGTNGQVLDSPSSS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_507602

• Blastp: Kinesin-like protein KIN-4A from Gossypium with 73.21% of identity
• Blastx: Kinesin-like protein KIN-4A from Arabidopsis with 71.91% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (107917911)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437938.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;