Protein coding transcript 123883

• Transcript: Ll_transcript_507587
• CDS coordinates: 3-623 (+)
• Peptide sequence: EKGAVQRERDHLLAEVENLANSDGQTQKSEDIHAQKLKALEAQILDLKKKQESQVQLLKQKQKSDEETKKLQDEIQSIKAQKVQLQQRIKQEAEQFRQWKASREKELLQLKKEGRRNEYERHKLQALNQRQKMVLQRKTEEAAMATKRLKDLLEARKTSIRDALVTMNGSGTNGQSNEKSLQRWLDHELEVMIKEQEVRFEYEKQSQ
• ORF Type: internal

Annotations of Ll_transcript_507587

• Blastp: Kinesin-like protein KIN-4A from Gossypium with 81.73% of identity
• Blastx: Kinesin-like protein KIN-4A from Gossypium with 81.73% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (107917911)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437932.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;