Protein coding transcript 123901

• Transcript: Ll_transcript_504998
• CDS coordinates: 542-1354 (+)
• Peptide sequence: MGYDLDNSQDGRDEDDEEEYEENDKGNHFLGFMFGNVDNSGDLDADYLDEDAKEHLSALADKLGPSLTDIDLSGRSPQTPPDVVEQDCGEKAEDAVDYEDIDEQYDGPETEAANEEMYLLPNKEFFSAEASLEVLESRASVFDDENYDEESEQEQDLVNDNSKIDGISLAGEQEKNSIDASKGESAQEHDLQVGLLQTEELDTEIQKLEEEGSEVLKRFTPLPVLCVEDGVTILRFSEIFSIHEPRRREEKREYRHSIPRERYNSFNFSDD
• ORF Type: 3prime_partial

Annotations of Ll_transcript_504998

• Blastp: Transcription initiation factor TFIID subunit 1 from Arabidopsis with 53.85% of identity
• Blastx: Transcription initiation factor TFIID subunit 1 from Arabidopsis with 53.85% of identity
• Eggnog: bromodomain(COG5076)
• Kegg: Link to kegg annotations (AT1G32750)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421079.1)
• Pfam: TATA box-binding protein binding (PF09247.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;