| Transcript | Ll_transcript_505946 |
|---|---|
| CDS coordinates | 169-528 (+) |
| Peptide sequence | MHTAINNWINLRLNMIISFVSFSYYFLMDWSYLFSCQTGHGGSDGLHGYVPSLDYVVADTGAFLEKIRSENPGIPCFLFGHSTGGAVVLKAASLPHIEVMVEGIILTSPALRVKPAHPIV |
| ORF Type | 3prime_partial |
| Blastp | Caffeoylshikimate esterase from Arabidopsis with 43.4% of identity |
|---|---|
| Blastx | - |
| Eggnog | alpha beta hydrolase fold(COG2267) |
| Kegg | Link to kegg annotations (AT1G52760) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019417940.1) |
| Pfam | Alpha/beta hydrolase family (PF12697.6) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer