Protein coding transcript 123946

• Transcript: Ll_transcript_505948
• CDS coordinates: 1027-1344 (+)
• Peptide sequence: MDWIGHGGSDGLHGYVPSLDHVVADTGAFLEKVRSENPGIPCFLFGHSTGGAVVLKAASLPHIEVMVEGIILTSPALRVKPAHPIVGVSCRLCIMCAINVFIISF*
• ORF Type: complete

Annotations of Ll_transcript_505948

• Blastp: Caffeoylshikimate esterase from Arabidopsis with 44.64% of identity
• Blastx: Monoglyceride lipase from Homo with 36.52% of identity
• Eggnog: alpha beta hydrolase fold(COG2267)
• Kegg: Link to kegg annotations (AT1G52760)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415146.1)
• Pfam: Serine aminopeptidase, S33 (PF12146.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;