Transcript | Ll_transcript_412061 |
---|---|
CDS coordinates | 199-1101 (+) |
Peptide sequence | MEKKEPLLQFALFQSSVDEGFWHRLSSLKLNKLGIDDSPIPLIGFYAPCSHSQVSNHLTLLAESLPSELSEASLTPETSHGNRNRCSVPGILYNTNTVESFHALDKQKLLKEVAGKIWDDILTGKAVEDCSVLSRFLVISFADLKRWSFHYWFCFPAVMLDPPATVVNLRPASQLLSTAEAESLSAACNKWRSSKSTTDVPFFVVMIDPNSCATVKLLKDWEAYQNDAHKILFGFYDPCHLANNPGWPLRNFLALITARWNLKSVQFFCYRENRGFADMDLSLVGEASVTVPQGRGALIL* |
ORF Type | complete |
Blastp | Ubiquitin-like modifier-activating enzyme atg7 from Arabidopsis with 68.12% of identity |
---|---|
Blastx | Ubiquitin-like modifier-activating enzyme atg7 from Arabidopsis with 68.64% of identity |
Eggnog | small protein activating enzyme activity(COG0476) |
Kegg | Link to kegg annotations (AT5G45900) |
CantataDB | Link to cantataDB annotations (CNT0001307) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019412946.1) |
Pfam | Ubiquitin-like modifier-activating enzyme ATG7 N-terminus (PF16420.4) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer