Protein coding transcript 124098

• Transcript: Ll_transcript_504851
• CDS coordinates: 49-1074 (+)
• Peptide sequence: MGDGASCGLAHPLDIQQLQIEAQHRWLRPSEICQILRNYRMFHITPEPHNRPPSGSLFIFDRKVLRYFRKDGHNWRKKKDGKTVKEAHEKLKVGSIDALHCYYAHGEDNENFQRRSYWMLEPDMMHIVFVHYLEVKGNKTAIGGIRESDDITSDFQKVTSQSSGFLSNYSSAPSPSTDSMSPTSSLTFSREDPDSEDIHQASSGLRPLCESQHKGNGILKDKLNAGLNSSYLLHPISGGHGLSSTSGTDYISFAPGDKFRGNDTTYSDGQKAHGMASWNDVLEQCTMELHTDPSLISFPSTSSSLVGNILDQEHTVFSDLLVGRSGLTEEAGSYQSLQSNWQ
• ORF Type: 3prime_partial

Annotations of Ll_transcript_504851

• Blastp: Calmodulin-binding transcription activator 2 from Arabidopsis with 48.25% of identity
• Blastx: Calmodulin-binding transcription activator 2 from Arabidopsis with 79.05% of identity
• Eggnog: Transcription activator(ENOG410XS5M)
• Kegg: Link to kegg annotations (AT5G64220)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440343.1)
• Pfam: CG-1 domain (PF03859.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;