Protein coding transcript 124100

• Transcript: Ll_transcript_504854
• CDS coordinates: 197-733 (+)
• Peptide sequence: MDNMDPSRAFLKDVKRIIIKVGTAVVTRQDGRLSVGKLGVLCEQIKELNSLGYEIILVSSGAVGLGRQRLRYRKLLNSSFADLQKPPVELDGKACAAVGQSSLMALYDTVFSQLDMTCAQLLVTDNDFRDKDFRKQLSETVKSLLSLKVIPVFNENDAVSTRKAPYEDSSGIFWDNDSL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_504854

• Blastp: Delta-1-pyrroline-5-carboxylate synthase from Vigna with 86.29% of identity
• Blastx: Delta-1-pyrroline-5-carboxylate synthase from Vigna with 86.29% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419158.1)
• Pfam: Amino acid kinase family (PF00696.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;