Transcript | Ll_transcript_504840 |
---|---|
CDS coordinates | 71-1096 (+) |
Peptide sequence | MGDGASCGLAHPLDIQQLQIEAQHRWLRPSEICQILRNYRMFHITPEPHNRPPSGSLFIFDRKVLRYFRKDGHNWRKKKDGKTVKEAHEKLKVGSIDALHCYYAHGEDNENFQRRSYWMLEPDMMHIVFVHYLEVKGNKTAIGGIRESDDITSDFQKVTSQSSGFLSNYSSAPSPSTDSMSPTSSLTFSREDPDSEDIHQASSGLRPLCESQHKGNGILKDKLNAGLNSSYLLHPISGGHGLSSTSGTDYISFAPGDKFRGNDTTYSDGQKAHGMASWNDVLEQCTMELHTDPSLISFPSTSSSLVGNILDQEHTVFSDLLVGRSGLTEEAGSYQSLQSNWQ |
ORF Type | 3prime_partial |
Blastp | Calmodulin-binding transcription activator 2 from Arabidopsis with 48.25% of identity |
---|---|
Blastx | Calmodulin-binding transcription activator 2 from Arabidopsis with 79.05% of identity |
Eggnog | Transcription activator(ENOG410XS5M) |
Kegg | Link to kegg annotations (AT5G64220) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019440343.1) |
Pfam | CG-1 domain (PF03859.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer