Transcript | Ll_transcript_505500 |
---|---|
CDS coordinates | 300-1148 (+) |
Peptide sequence | MKVIGKLSEGKASHVPYRDSKLTRLLQTSLSGHGHVSLICTVTPASSNMEETHNTLKFASRAKRVEIYASCNKIIDEKSLIKKYQREISALKQELDHLKKGMLVGVSHEEIMSLKQKLEEGQVKMRSRLEEEEDAKVALMSRIQRLTKLILVSSKNAIPGYLTDAPSHQRSHSVGEDDKYDVFHDGSLFIESGSQKDVSTLSSDLSLDVRHRRSSSRRNDELSPTSSIITKSTQAGELMSRARLPVVDSSSPSPSIISVCQFICILNASILRASDSSAEINA* |
ORF Type | complete |
Blastp | Kinesin-like protein KIN-7D, mitochondrial from Arabidopsis with 75.11% of identity |
---|---|
Blastx | Kinesin-like protein KIN-7D, mitochondrial from Arabidopsis with 75.11% of identity |
Eggnog | Kinesin family member(COG5059) |
Kegg | Link to kegg annotations (AT4G39050) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019413364.1) |
Pfam | Kinesin motor domain (PF00225.22) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer