Protein coding transcript 124136

• Transcript: Ll_transcript_505500
• CDS coordinates: 300-1148 (+)
• Peptide sequence: MKVIGKLSEGKASHVPYRDSKLTRLLQTSLSGHGHVSLICTVTPASSNMEETHNTLKFASRAKRVEIYASCNKIIDEKSLIKKYQREISALKQELDHLKKGMLVGVSHEEIMSLKQKLEEGQVKMRSRLEEEEDAKVALMSRIQRLTKLILVSSKNAIPGYLTDAPSHQRSHSVGEDDKYDVFHDGSLFIESGSQKDVSTLSSDLSLDVRHRRSSSRRNDELSPTSSIITKSTQAGELMSRARLPVVDSSSPSPSIISVCQFICILNASILRASDSSAEINA*
• ORF Type: complete

Annotations of Ll_transcript_505500

• Blastp: Kinesin-like protein KIN-7D, mitochondrial from Arabidopsis with 75.11% of identity
• Blastx: Kinesin-like protein KIN-7D, mitochondrial from Arabidopsis with 75.11% of identity
• Eggnog: Kinesin family member(COG5059)
• Kegg: Link to kegg annotations (AT4G39050)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413364.1)
• Pfam: Kinesin motor domain (PF00225.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;