Protein coding transcript 124205

• Transcript: Ll_transcript_505814
• CDS coordinates: 431-970 (+)
• Peptide sequence: MVKKFEKYWDDYSVVLAMGAILDPRVKLETLNYCFERVDDSEFETKLQLVKRKLYMLFEQYRNTSAPTSMQTLTSDAPQKKAKVQDLDYMFDELDRHKTQLATKMGKSQLDLYLDEVSLNFKDNNDLDVVQWWKENKSRFPELSIMARDLLCIPITTVASESAFSTCLYVLKKYRSRLL*
• ORF Type: complete

Annotations of Ll_transcript_505814

• Blastp: Zinc finger BED domain-containing protein DAYSLEEPER from Arabidopsis with 30.9% of identity
• Blastx: Zinc finger BED domain-containing protein RICESLEEPER 2 from Oryza sativa with 29.05% of identity
• Eggnog: zinc finger(ENOG41115TD)
• Kegg: Link to kegg annotations (AT3G42170)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459986.1)
• Pfam: Domain of unknown function (DUF4413) (PF14372.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;