Protein coding transcript 124213

• Transcript: Ll_transcript_505810
• CDS coordinates: 454-843 (+)
• Peptide sequence: MSPPRTGSELSKKILEFLNEWGIDKNIFSLTLDNVSSNDVMQEQLKNKLIVENSLLCDGQLFLVRCSAHILNILVQEGLKVASDNLYKIRDSIKCVRGSEGRMLKLMVCIEKIGGVDASIDLCLDVPTG*
• ORF Type: complete

Annotations of Ll_transcript_505810

• Blastp: Zinc finger BED domain-containing protein RICESLEEPER 2 from Oryza sativa with 36.43% of identity
• Blastx: Zinc finger BED domain-containing protein RICESLEEPER 2 from Oryza sativa with 33.52% of identity
• Eggnog: transposon protein(ENOG410Y37V)
• Kegg: Link to kegg annotations (4334009)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414580.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;