| Transcript | Ll_transcript_505811 |
|---|---|
| CDS coordinates | 140-529 (+) |
| Peptide sequence | MPPPHTGSELSKKILEFLNEWGINKKIFSLTLDNASSNDVMQEQLKNKLIMENSLLCDGQFFHVRCSAHILNLIVQEGLKVASDNLYKIRDSIKCVRGSEGRMLKLMVCIEKIGGVDASIDLCLDVPTG* |
| ORF Type | complete |
| Blastp | Putative AC transposase from Zea with 38.4% of identity |
|---|---|
| Blastx | Zinc finger BED domain-containing protein RICESLEEPER 2 from Oryza sativa with 38.67% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019414580.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer