Protein coding transcript 124235

• Transcript: Ll_transcript_505343
• CDS coordinates: 1110-1541 (+)
• Peptide sequence: MSMLVFHSIAENVYQSQLIGHALCSLMFGPDLCRSQTKKLHVILSYQGQNYPIRKDLQCETDKLTHFYTFILRPDATYSVPVDNRERDSGSMYIDWDILPPKKIKDVNAKKPIDWDDREYIEDPNDAKPEVLSVPRSAQIFRC*
• ORF Type: complete

Annotations of Ll_transcript_505343

• Blastp: Calreticulin-3 from Arabidopsis with 75.4% of identity
• Blastx: Calreticulin-3 from Arabidopsis with 76% of identity
• Eggnog: Calreticulin(ENOG410XRR7)
• Kegg: Link to kegg annotations (AT1G08450)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020216554.1)
• Pfam: Calreticulin family (PF00262.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;