Protein coding transcript 124239

• Transcript: Ll_transcript_505353
• CDS coordinates: 304-708 (+)
• Peptide sequence: MFGPDLCRSQTKKLHVILSYQGQNYPIRKDLQCETDKLTHFYTFILRPDATYSVPVDNRERDSGSMYIDWDILPPKKIKDVNAKKPIDWDDREYIEDPNDAKPEGYDSIPAEIPDPKVKEVYVFTTHLEFKRCQ*
• ORF Type: complete

Annotations of Ll_transcript_505353

• Blastp: Calreticulin-3 from Arabidopsis with 81.67% of identity
• Blastx: Calreticulin-3 from Arabidopsis with 83.33% of identity
• Eggnog: Calreticulin(ENOG410XRR7)
• Kegg: Link to kegg annotations (AT1G08450)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003541149.1)
• Pfam: Calreticulin family (PF00262.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;