Transcript | Ll_transcript_505333 |
---|---|
CDS coordinates | 1300-1923 (+) |
Peptide sequence | MENLLFSLLQPADWDDKEYIEDPKDVKPEGYDSVPSEIPDPKAKEPVDWDEEEDGLWKAPKIPNPAYKGPWKNKKIKNPNYKGKWKVPWIDNPEFEDDPDLYVLKPIKYVGIEVWQVKAGSIFDNILICDDPQYARQVVEGYMTDNREPEKEAFEEAEKVRKAKEEEEAQRAREEGEKRRRERGHKHGDRRRRSRHDHMDDYYHDEL* |
ORF Type | complete |
Blastp | Calreticulin-3 from Arabidopsis with 75.25% of identity |
---|---|
Blastx | Calreticulin-3 from Arabidopsis with 89.78% of identity |
Eggnog | Calreticulin(ENOG410XRR7) |
Kegg | Link to kegg annotations (AT1G08450) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019454141.1) |
Pfam | Calreticulin family (PF00262.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer