Protein coding transcript 124269

• Transcript: Ll_transcript_464856
• CDS coordinates: 771-1370 (+)
• Peptide sequence: MRFFSLLVNGCLYSMEQVVASYSAPGAARQVDIQVSNSSGSLVLHWGVVHDRQGWVLPSRSPDGTKVYKNRALRTPFVKSGSGSFLKIDVDDPAAKAVEFLILDESQNKWFKNNGENFHIKLPVKHKLAQQVSVPEDLVQVQAYIRWERKGKQMYTPEQEKVSNRVFMCFIFHLASNLQVCFLLRFVQLILLRFPGFSI*
• ORF Type: complete

Annotations of Ll_transcript_464856

• Blastp: Alpha-glucan water dikinase, chloroplastic from Citrus with 67.81% of identity
• Blastx: Alpha-glucan water dikinase, chloroplastic from Citrus with 67.81% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421636.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;