| Transcript | Ll_transcript_495689 |
|---|---|
| CDS coordinates | 2-316 (+) |
| Peptide sequence | SSSDDKAFVPQVVSLGPYHHGKRFLHQMDHHKWRSLTHVLKRTNHHLGLYLDSMKEIEEKARSCYEGTISLNCNEFVEMLVLDGCFVLELFRGATEGFTQLGYSR |
| ORF Type | internal |
| Blastp | UPF0481 protein At3g47200 from Arabidopsis with 34.83% of identity |
|---|---|
| Blastx | UPF0481 protein At3g47200 from Arabidopsis with 34.83% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (AT3G47200) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019421152.1) |
| Pfam | Plant protein of unknown function (PF03140.14) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer