Protein coding transcript 124302

• Transcript: Ll_transcript_464421
• CDS coordinates: 2-370 (+)
• Peptide sequence: REKHDEHMLRELVKRWANHKLMVRWLSRFFHYLDRYFIARRSLPSLNEVGLTCFRDLVYKELNGKVRDAVISLIDQEREGEQIDRALLKNILDIFVEIGMGQMDHYENDFEAFMLKDTSAYYS
• ORF Type: internal

Annotations of Ll_transcript_464421

• Blastp: Cullin-1 from Arabidopsis with 82.11% of identity
• Blastx: Cullin-1 from Arabidopsis with 82.11% of identity
• Eggnog: cullin 1(COG5647)
• Kegg: Link to kegg annotations (AT4G02570)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437709.1)
• Pfam: Cullin family (PF00888.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;