Transcript | Ll_transcript_464403 |
---|---|
CDS coordinates | 2-451 (+) |
Peptide sequence | LSLNSISSFHFSYTIQISISLSRFCFGFSFARFTLQDFGFVITSMSERKTIDLEQGWDFMHKGITKLKNILEGLPEPQFSSEDYMMLYTTIYNMCTQKPPHDYSQQLYDKYRESFEEYILSTVSLVLLLNLCNLLSLLCMLSIGLVWFL* |
ORF Type | 5prime_partial |
Blastp | Cullin-1 from Arabidopsis with 87.01% of identity |
---|---|
Blastx | Cullin-1 from Arabidopsis with 87.67% of identity |
Eggnog | cullin 1(COG5647) |
Kegg | Link to kegg annotations (AT4G02570) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019450940.1) |
Pfam | Cullin family (PF00888.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer