Protein coding transcript 124309

• Transcript: Ll_transcript_462967
• CDS coordinates: 303-1019 (+)
• Peptide sequence: MSNGFANGSSPRRRRPENDIEAGIPSNRSGDFADADLADPFDITSTKNASFERLKRWRQAALVLNASRRFRYTLDLKKEEEKKQVLRKIRAHAQAIRAAHLFKAAAVPVGQANETVKPPSTSTGEFPIGQEQLASISRDHDTIALQQYGGVAGISDLLKTDLEKGVHDDEAELLKRRNTFGSNNYPRKKGRNFLMFLWDACKDLTLIILIVAAAASLALGIKSEGIKEGWYDGGSIAFA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_462967

• Blastp: Calcium-transporting ATPase 10, plasma membrane-type from Arabidopsis with 65% of identity
• Blastx: Calcium-transporting ATPase 10, plasma membrane-type from Arabidopsis with 64.58% of identity
• Eggnog: ATPase, Ca transporting, plasma membrane(ENOG410XNNC)
• Kegg: Link to kegg annotations (AT4G29900)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431135.1)
• Pfam: Ca2+-ATPase N terminal autoinhibitory domain (PF12515.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;