| Transcript | Ll_transcript_465151 |
|---|---|
| CDS coordinates | 1379-1846 (+) |
| Peptide sequence | MPFGLMNVPATFQATMNDVFRSFLRNFVLVFFDDILVYSRNEEEHVHHLHQVLRVLQDHCFVDNKNKCNFGCRSVHYLGHMIWGNGVAVDPEKVKCVVEWLKPKTDKGVRGFLGLTGYYRKFIRDYGKITKLLTELTKKDNFLQSSSALEAFNRL* |
| ORF Type | complete |
| Blastp | Retrovirus-related Pol polyprotein from transposon 17.6 from Sophophora with 36.13% of identity |
|---|---|
| Blastx | Transposon Ty3-G Gag-Pol polyprotein from Saccharomyces with 38.44% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_014632080.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer