Protein coding transcript 124379

• Transcript: Ll_transcript_463842
• CDS coordinates: 2-616 (+)
• Peptide sequence: KNPVVSNRCSFRAFASLSESSSIFILHSPIFNSMATLPTFITSNQQHDPLLPFLRSVKKALEGSSASDSDLSKLLLNCITSFKHSDQYRNDVRFLKIWLLYMGVSADFDTVFKEMLDSKVCVNDSSLYVWSASFFELKGRLRDALTIYQLGISRNAEPIEWLKKAHTLFLSRISEIRNAASSQKVCIMEQSLTVKKLSQIYILLF
• ORF Type: internal

Annotations of Ll_transcript_463842

• Blastp: Mitotic checkpoint serine/threonine-protein kinase BUB1 from Arabidopsis with 46.81% of identity
• Blastx: Mitotic checkpoint serine/threonine-protein kinase BUB1 from Arabidopsis with 43.97% of identity
• Eggnog: Budding uninhibited by benzimidazoles 1 homolog(ENOG410XQ67)
• Kegg: Link to kegg annotations (AT2G20635)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453707.1)
• Pfam: Mad3/BUB1 homology region 1 (PF08311.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;