Protein coding transcript 124415

• Transcript: Ll_transcript_463892
• CDS coordinates: 3-641 (+)
• Peptide sequence: DFVRMNARDEADECAPRELLEEIYDSIVKEEIKMKDDASLIGKGSKQKSEGEEGRLVSILNLALPKRKSSADAKSESEAIIRKTQAIFRSQGVKRGVFYTAQQIELVRPMVEAVGWPLLATFSVTMEEVENKPRVVLLMEGFKAGIHVAYVLGMDTMRYAFLTSLVRFTFLHAPKEMRSKNVEALRTLLVLCESDTDSLQDTWNAILECVSRL
• ORF Type: internal

Annotations of Ll_transcript_463892

• Blastp: Brefeldin A-inhibited guanine nucleotide-exchange protein 5 from Arabidopsis with 75.23% of identity
• Blastx: Brefeldin A-inhibited guanine nucleotide-exchange protein 5 from Arabidopsis with 75.23% of identity
• Eggnog: and Sec7 domain(COG5307)
• Kegg: Link to kegg annotations (AT3G43300)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455516.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;