| Transcript | Ll_transcript_463866 |
|---|---|
| CDS coordinates | 144-617 (+) |
| Peptide sequence | MSEEEKLLKEAKKLPWEDRLFHKNWKVRNEANIDLASLCDSISDPKDPRIREFGHFFKKTVVDSNAPVQEKALDALIAYLRAADADAGRYGKEVCDAVVAKCLTGRTKTVEKAQAVFMLWVELEAVDAFLVLLFCAFYLVASGWFSSFIFWGVFFRG* |
| ORF Type | complete |
| Blastp | Protein MOR1 from Arabidopsis with 81.4% of identity |
|---|---|
| Blastx | Protein MOR1 from Arabidopsis with 81.03% of identity |
| Eggnog | microtubule binding(ENOG410XPTW) |
| Kegg | Link to kegg annotations (AT2G35630) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019427922.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer