Protein coding transcript 124693

• Transcript: Ll_transcript_465595
• CDS coordinates: 100-1188 (+)
• Peptide sequence: MKEQGVSEDRLQLLREVTGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGEVRISGFPKNQETFARISGYCEQTDIHSPQVTVKESLIYSAFLRLPKEVSDEEKMKFVEEVMDLVELNNLKDAIVGLPGVTGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELLLMKRGGQVIYSGPLGRNSHKIVEYFEAIPGVSKIKDKYNPATWMLEVSSIAAEVRLGMDFAEYYKTSALAQRNKALVKELSVPPPEAKDLYFPSQYSQPTMGQFKSCLWKQYLTYWRSPDYNLVRYMFTLLVALVVGTVFWKVGTKRFGVALL*
• ORF Type: complete

Annotations of Ll_transcript_465595

• Blastp: ABC transporter G family member 29 from Arabidopsis with 83.03% of identity
• Blastx: ABC transporter G family member 36 from Arabidopsis with 68.14% of identity
• Eggnog: (ABC) transporter(COG0842)
• Kegg: Link to kegg annotations (AT3G16340)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458104.1)
• Pfam: ABC transporter (PF00005.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;