Transcript | Ll_transcript_465582 |
---|---|
CDS coordinates | 100-960 (+) |
Peptide sequence | MKEQGVSEDRLQLLREVTGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGEVRISGFPKNQETFARISGYCEQTDIHSPQVTVRESLIYSAFLRLPKEVSDEEKMKFVEEVMDLVELNNLKDAIVGLPGVTGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELLLMKRGGQVIYSGPLGRNSHKIVEYFEEIQGVPKIKDKYNPATWMLEVSSIAAEVRLGMDFAEYYKTSALAQRNKALVK |
ORF Type | 3prime_partial |
Blastp | ABC transporter G family member 29 from Arabidopsis with 86.62% of identity |
---|---|
Blastx | ABC transporter G family member 29 from Arabidopsis with 86.62% of identity |
Eggnog | (ABC) transporter(COG0842) |
Kegg | Link to kegg annotations (AT3G16340) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019458104.1) |
Pfam | ABC transporter (PF00005.26) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer