Protein coding transcript 124780

• Transcript: Ll_transcript_464138
• CDS coordinates: 168-572 (+)
• Peptide sequence: MCHLIIVQHHFGPLTLLFLFPVVLQEHLLIVCELLKANLYEFHKFNRESGGEVYFTMPRLQSITIQCLESLQFLHSLGLIHCDLKPENILVKSYSRCEVKVIDLGSSCFETDHLSSYVQSRSYRAPEVILGLPYD
• ORF Type: 3prime_partial

Annotations of Ll_transcript_464138

• Blastp: Probable serine/threonine-protein kinase dyrk2 from Dictyostelium with 47.32% of identity
• Blastx: Dual specificity tyrosine-phosphorylation-regulated kinase 2 from Mus with 48.18% of identity
• Eggnog: dual-specificity tyrosine-(Y)-phosphorylation regulated kinase(ENOG410XPET)
• Kegg: Link to kegg annotations (DDB_G0293750)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_017423362.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;