Protein coding transcript 12479

• Transcript: Ll_transcript_411610
• CDS coordinates: 59-628 (+)
• Peptide sequence: MANGMSVVVKRMREMNKVSRDIFDAEMRRFGRLRHPNIMTPLAYHYRREEKLFVTEYMPKGSLLYVLHGDRGMSHAELNWPKRLNIVKGIARGLGFLYSEFSSEDLPHGNLKSSNVLLTDNYEPLLSDFAFHALINASYSVQTMFAYKTPDYVQYQTVSQKTDVYCLGIIILEMMTGKFPSQYHSNGKGG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_411610

• Blastp: Pollen receptor-like kinase 3 from Arabidopsis with 68.42% of identity
• Blastx: Pollen receptor-like kinase 3 from Arabidopsis with 70.33% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT3G42880)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462574.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;