| Transcript | Ll_transcript_464430 |
|---|---|
| CDS coordinates | 3-317 (+) |
| Peptide sequence | RNRLLLCILNICKDVLGHLPKVVGIDVVEMALWAKENRPSVSTPRNVQDGGPIASAVPETELKVNVEKELVSQAEEEEMEALLGTYVMGIGEAEAFSERLKRELQ |
| ORF Type | internal |
| Blastp | Exocyst complex component SEC3A from Arabidopsis with 80.95% of identity |
|---|---|
| Blastx | Exocyst complex component SEC3A from Arabidopsis with 80.95% of identity |
| Eggnog | Exocyst complex component(ENOG410XQEE) |
| Kegg | Link to kegg annotations (AT1G47550) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019430732.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer