Protein coding transcript 124831

• Transcript: Ll_transcript_464438
• CDS coordinates: 120-770 (+)
• Peptide sequence: MAKSSADDIELRRACVSAIDDPTQKIIISIRVSKSRGIFGKSSKLVHQMAKPRVLALFTQSKGQSTTAFLRVLKYSTGGVLEPAKLYKLKHLSKVEVITNDPSGCTFTLGFDNLRSQSVAPPLWTMRNIDDRNRLLLCILNTCKDVLGRLPKVVGIDVVEMALWAKENRPSVSTQRNVQDGGPVASAVPENELKVNVEKELVSQAEEEDMEALLGT*
• ORF Type: complete

Annotations of Ll_transcript_464438

• Blastp: Exocyst complex component SEC3A from Arabidopsis with 79.17% of identity
• Blastx: Exocyst complex component SEC3A from Arabidopsis with 78.77% of identity
• Eggnog: Exocyst complex component(ENOG410XQEE)
• Kegg: Link to kegg annotations (AT1G47550)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443165.1)
• Pfam: Exocyst complex component SEC3 N-terminal PIP2 binding PH (PF15277.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;