Transcript | Ll_transcript_464821 |
---|---|
CDS coordinates | 1-324 (+) |
Peptide sequence | SDFLAQGFGSLGLMTSVLVCPDGKTIESEAAHGTVTRHYRVHQKGGETSTNSIASIFAWSRGLAHRAKLDGNARLLDFTAKLEAACVGTVETGKMTKDLALLVHGPK* |
ORF Type | 5prime_partial |
Blastp | Cytosolic isocitrate dehydrogenase [NADP] from Arabidopsis with 90.65% of identity |
---|---|
Blastx | Cytosolic isocitrate dehydrogenase [NADP] from Arabidopsis with 90.65% of identity |
Eggnog | isocitrate dehydrogenase (NADp)(COG0538) |
Kegg | Link to kegg annotations (AT1G65930) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019431246.1) |
Pfam | Isocitrate/isopropylmalate dehydrogenase (PF00180.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer