Protein coding transcript 124862

• Transcript: Ll_transcript_464840
• CDS coordinates: 130-786 (+)
• Peptide sequence: MNFAYQKRWPLYLSTKNTILKKYDGRFKDIFQEVFDAQWSRKFKDAGIWYEHRLIDDMVAYAVKSDGGYVWACKNYDGDVQSDFLAQGFGSLGLMTSVLVCPDGKTIESEAAHGTVTRHYRVHQKGGETSTNSIASIFAWSRGLAHRAKLDRNATLLDFTEKLEAACIGTVESGKMTKDLALLVHGPKVSRSQYLNTEEFIDAVAEDLRSRLSTKAKL*
• ORF Type: complete

Annotations of Ll_transcript_464840

• Blastp: Isocitrate dehydrogenase [NADP] from Nicotiana with 85.85% of identity
• Blastx: Isocitrate dehydrogenase [NADP] from Nicotiana with 85.14% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (107815853)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424646.1)
• Pfam: Isocitrate/isopropylmalate dehydrogenase (PF00180.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;