Protein coding transcript 124864

• Transcript: Ll_transcript_464809
• CDS coordinates: 38-394 (+)
• Peptide sequence: MYNTDESIRAFAEASMNFAYQKRWPLYLSTKNTILKKYDGRFKDIFQEVFDAQWSRKFKDAGIWYEHRLIDDMVAYAVKSDGGYVWACKNYDGDVQSDFLAQGFGSLGLMTSVLVSLF*
• ORF Type: complete

Annotations of Ll_transcript_464809

• Blastp: Isocitrate dehydrogenase [NADP] from Solanum with 87.4% of identity
• Blastx: Isocitrate dehydrogenase [NADP] from Nicotiana with 72.34% of identity
• Eggnog: isocitrate dehydrogenase (NADp)(COG0538)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431246.1)
• Pfam: Isocitrate/isopropylmalate dehydrogenase (PF00180.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;