Protein coding transcript 124866

• Transcript: Ll_transcript_464819
• CDS coordinates: 1-414 (+)
• Peptide sequence: SDFLAQGFGSLGLMTSVLVCPDGKTIESEAAHGTVTRHYRVHQKGGETSTNSIASIFAWSRGLAHRAKLDGNARLLDFTAKLEAACVGTVETGKMTKDLALLVHGPKVSRSQYLNTEEFIDAVAEDLRTRLYTKARM*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_464819

• Blastp: Cytosolic isocitrate dehydrogenase [NADP] from Arabidopsis with 87.02% of identity
• Blastx: Cytosolic isocitrate dehydrogenase [NADP] from Arabidopsis with 87.02% of identity
• Eggnog: isocitrate dehydrogenase (NADp)(COG0538)
• Kegg: Link to kegg annotations (AT1G65930)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431246.1)
• Pfam: Isocitrate/isopropylmalate dehydrogenase (PF00180.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;