Transcript | Ll_transcript_464942 |
---|---|
CDS coordinates | 250-600 (+) |
Peptide sequence | MAAESVIEENKLTLYSYWRSSCSFRLRIALNLKSLSYHYKSVNLLKGEQSHPEFLKLNPVGFVPVLVDGPVVLTDSFAIIMVSHSNPPSLFNSIVYSQFYFFRNFFHDFLNLCKTN* |
ORF Type | complete |
Blastp | Glutathione S-transferase zeta class from Euphorbia sect. Esula with 66.67% of identity |
---|---|
Blastx | Glutathione S-transferase zeta class from Euphorbia sect. Esula with 68.07% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019436148.1) |
Pfam | Glutathione S-transferase, N-terminal domain (PF02798.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer